LAPTM4A polyclonal antibody
  • LAPTM4A polyclonal antibody

LAPTM4A polyclonal antibody

Ref: AB-PAB22778
LAPTM4A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LAPTM4A.
Información adicional
Size 100 uL
Gene Name LAPTM4A
Gene Alias HUMORF13|KIAA0108|LAPTM4|MBNT|Mtrp
Gene Description lysosomal protein transmembrane 4 alpha
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EVTHPNSMPAVNIQYEVIGNYYSSERMADN
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LAPTM4A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9741
Iso type IgG

Enviar uma mensagem


LAPTM4A polyclonal antibody

LAPTM4A polyclonal antibody