RSHL3 polyclonal antibody
  • RSHL3 polyclonal antibody

RSHL3 polyclonal antibody

Ref: AB-PAB22777
RSHL3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RSHL3.
Información adicional
Size 100 uL
Gene Name RSHL3
Gene Alias FLJ37974|MGC126303|dJ412I7.1
Gene Description radial spokehead-like 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq DVSYNNAKQKELRFDVFQEEDSNSDYDLQQPAPGGSEVAPSMLEITIQNAKAYLLKTSSNSGFNLYDHLSNMLTKI
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RSHL3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 345895
Iso type IgG

Enviar uma mensagem


RSHL3 polyclonal antibody

RSHL3 polyclonal antibody