OFD1 polyclonal antibody
  • OFD1 polyclonal antibody

OFD1 polyclonal antibody

Ref: AB-PAB22774
OFD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OFD1.
Información adicional
Size 100 uL
Gene Name OFD1
Gene Alias 71-7A|CXorf5|MGC117039|MGC117040|SGBS2
Gene Description oral-facial-digital syndrome 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SFEETYDRKLKNELLKYQLELKDDYIIRTNRLIEDERKNKEKAVHLQEELIAINSKKEELNQSVNRVKELELELESVKAQSLAITKQNH
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OFD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8481
Iso type IgG

Enviar uma mensagem


OFD1 polyclonal antibody

OFD1 polyclonal antibody