LGSN polyclonal antibody
  • LGSN polyclonal antibody

LGSN polyclonal antibody

Ref: AB-PAB22768
LGSN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LGSN.
Información adicional
Size 100 uL
Gene Name LGSN
Gene Alias GLULD1|LGS|MGC163238|MGC163240
Gene Description lengsin, lens protein with glutamine synthetase domain
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IISFPALTFLNNHDQPFMQELVDGLYHTGANVESFSSSTRPGQMEISFLPEFGISSADNAFTLRTGVKEVARKYNYIASFFIETGFCDSGI
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LGSN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51557
Iso type IgG

Enviar uma mensagem


LGSN polyclonal antibody

LGSN polyclonal antibody