SH3YL1 polyclonal antibody
  • SH3YL1 polyclonal antibody

SH3YL1 polyclonal antibody

Ref: AB-PAB22766
SH3YL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SH3YL1.
Información adicional
Size 100 uL
Gene Name SH3YL1
Gene Alias DKFZp586F1318|FLJ39121|Ray
Gene Description SH3 domain containing, Ysc84-like 1 (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MNNPIPSNLKSEAKKAAKILREFTEITSRNGPDKIIPAHVIAKAKGLAILSVIKAGFLVTARGGSGIVV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SH3YL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26751
Iso type IgG

Enviar uma mensagem


SH3YL1 polyclonal antibody

SH3YL1 polyclonal antibody