ZNF843 polyclonal antibody
  • ZNF843 polyclonal antibody

ZNF843 polyclonal antibody

Ref: AB-PAB22764
ZNF843 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF843.
Información adicional
Size 100 uL
Gene Name ZNF843
Gene Alias MGC46336
Gene Description zinc finger protein 843
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq RAPTCCSTGRFTQGRQPCKCKACGRGFTQSASLLQHWRVHSDWRETLSLSPVRQDLLWPLQPHQAPASPLGRSHSSAGVRQGFSG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF843.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 283933
Iso type IgG

Enviar uma mensagem


ZNF843 polyclonal antibody

ZNF843 polyclonal antibody