PMM1 polyclonal antibody
  • PMM1 polyclonal antibody

PMM1 polyclonal antibody

Ref: AB-PAB22761
PMM1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PMM1.
Información adicional
Size 100 uL
Gene Name PMM1
Gene Alias Sec53
Gene Description phosphomannomutase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PMM1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5372
Iso type IgG

Enviar uma mensagem


PMM1 polyclonal antibody

PMM1 polyclonal antibody