PRDM6 polyclonal antibody
  • PRDM6 polyclonal antibody

PRDM6 polyclonal antibody

Ref: AB-PAB22756
PRDM6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PRDM6.
Información adicional
Size 100 uL
Gene Name PRDM6
Gene Alias -
Gene Description PR domain containing 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RGTELLVWYNDSYTSFFGIPLQCIAQDENLNVPSTVMEAMCRQDALQPFNKSSKLAPTTQQRSVVFPQTPCSRNFSLLDKSG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PRDM6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 93166
Iso type IgG

Enviar uma mensagem


PRDM6 polyclonal antibody

PRDM6 polyclonal antibody