NCOA7 polyclonal antibody
  • NCOA7 polyclonal antibody

NCOA7 polyclonal antibody

Ref: AB-PAB22752
NCOA7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NCOA7.
Información adicional
Size 100 uL
Gene Name NCOA7
Gene Alias ERAP140|ESNA1|FLJ45605|MGC88425|Nbla00052|Nbla10993|dJ187J11.3
Gene Description nuclear receptor coactivator 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NDVELKGALDLETCEKQDIMPEVDKQSGSPESRVENTLNIHEDLDKVKLIEYYLTKNKEGPQVSENLQKTELSDG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NCOA7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 135112
Iso type IgG

Enviar uma mensagem


NCOA7 polyclonal antibody

NCOA7 polyclonal antibody