SLFN14 polyclonal antibody
  • SLFN14 polyclonal antibody

SLFN14 polyclonal antibody

Ref: AB-PAB22734
SLFN14 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLFN14.
Información adicional
Size 100 uL
Gene Name SLFN14
Gene Alias -
Gene Description schlafen family member 14
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VFSLPLRICSLRSNLYRRDVTSAINLSASSALELLREKGFRAQRGRPRVKKLHPQQVLNRCIQEEEDMRILASEFFKKDKLMYKEKLNF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLFN14.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 342618
Iso type IgG

Enviar uma mensagem


SLFN14 polyclonal antibody

SLFN14 polyclonal antibody