GPR111 polyclonal antibody
  • GPR111 polyclonal antibody

GPR111 polyclonal antibody

Ref: AB-PAB22726
GPR111 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GPR111.
Información adicional
Size 100 uL
Gene Name GPR111
Gene Alias PGR20|hGPCR35
Gene Description G protein-coupled receptor 111
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CDGVCTDYSQCTQPCPPDTQGNMGFSCRQKTWHKITDTCRTLNALNIFEEDSRLVQPFEDNIKISVYTGKSETITDMLLQKCPTD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GPR111.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 222611
Iso type IgG

Enviar uma mensagem


GPR111 polyclonal antibody

GPR111 polyclonal antibody