CCDC39 polyclonal antibody
  • CCDC39 polyclonal antibody

CCDC39 polyclonal antibody

Ref: AB-PAB22725
CCDC39 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC39.
Información adicional
Size 100 uL
Gene Name CCDC39
Gene Alias DKFZp434A128
Gene Description coiled-coil domain containing 39
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ILDNELTETISAQLELDKAAQDFRKIHNERQELIKQWENTIEQMQKRDGDIDNCALELARIKQETREKENLVKEKIKFLESEIGNNTEFEKRISVADR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC39.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 339829
Iso type IgG

Enviar uma mensagem


CCDC39 polyclonal antibody

CCDC39 polyclonal antibody