SRP72 polyclonal antibody
  • SRP72 polyclonal antibody

SRP72 polyclonal antibody

Ref: AB-PAB22716
SRP72 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SRP72.
Información adicional
Size 100 uL
Gene Name SRP72
Gene Alias -
Gene Description signal recognition particle 72kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq ENALKTIESANQQTDKLKELYGQVLYRLERYDECLAVYRDLVRNSQDDYDEERKTNLSAVVAAQSNWEKVVPENLGLQEGTHELCYNTACA
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SRP72.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6731
Iso type IgG

Enviar uma mensagem


SRP72 polyclonal antibody

SRP72 polyclonal antibody