SKIV2L2 polyclonal antibody
  • SKIV2L2 polyclonal antibody

SKIV2L2 polyclonal antibody

Ref: AB-PAB22712
SKIV2L2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SKIV2L2.
Información adicional
Size 100 uL
Gene Name SKIV2L2
Gene Alias Dob1|KIAA0052|MGC142069|Mtr4|fSAP118
Gene Description superkiller viralicidic activity 2-like 2 (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq LVVDENGDFREDNFNTAMQVLRDAGDLAKGDQKGRKGGTKGPSNVFKIVKMIMERNFQPVIIFSFSKKDCEAYALQMTK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SKIV2L2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23517
Iso type IgG

Enviar uma mensagem


SKIV2L2 polyclonal antibody

SKIV2L2 polyclonal antibody