KIAA0182 polyclonal antibody
  • KIAA0182 polyclonal antibody

KIAA0182 polyclonal antibody

Ref: AB-PAB22710
KIAA0182 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA0182.
Información adicional
Size 100 uL
Gene Name KIAA0182
Gene Alias GSE1
Gene Description KIAA0182
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LDTSSEKLEFLQLFGLTTQQQKEELVAQKRRKRRRMLRERSPSPPTIQSKRQTPSPRLALSTRYSPDEMNNSPNFEEKKKFLTIFNLTH
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA0182.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23199
Iso type IgG

Enviar uma mensagem


KIAA0182 polyclonal antibody

KIAA0182 polyclonal antibody