NSUN3 polyclonal antibody
  • NSUN3 polyclonal antibody

NSUN3 polyclonal antibody

Ref: AB-PAB22708
NSUN3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NSUN3.
Información adicional
Size 100 uL
Gene Name NSUN3
Gene Alias FLJ22109|FLJ22609|MST077|MSTP077
Gene Description NOL1/NOP2/Sun domain family, member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq PGGKSIALLQCACPGYLHCNEYDSLRLRWLRQTLESFIPQPLINVIKVSELDGRKMGDAQPEMFDKVLVDAPCSNDRSWLFSSDSQKASCRISQR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NSUN3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 63899
Iso type IgG

Enviar uma mensagem


NSUN3 polyclonal antibody

NSUN3 polyclonal antibody