KAAG1 polyclonal antibody
  • KAAG1 polyclonal antibody

KAAG1 polyclonal antibody

Ref: AB-PAB22702
KAAG1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KAAG1.
Información adicional
Size 100 uL
Gene Name KAAG1
Gene Alias MGC78738|RU2AS
Gene Description kidney associated antigen 1
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KAAG1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 353219
Iso type IgG

Enviar uma mensagem


KAAG1 polyclonal antibody

KAAG1 polyclonal antibody