ALS2CR12 polyclonal antibody
  • ALS2CR12 polyclonal antibody

ALS2CR12 polyclonal antibody

Ref: AB-PAB22697
ALS2CR12 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ALS2CR12.
Información adicional
Size 100 uL
Gene Name ALS2CR12
Gene Alias -
Gene Description amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HSARQEETNKSFYEVINVSPGYQLVRNREQISVTLGDEMFDRKKRWESEIPDKGRFSRTNIISDLEEQISELTAIIEQMNR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ALS2CR12.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 130540
Iso type IgG

Enviar uma mensagem


ALS2CR12 polyclonal antibody

ALS2CR12 polyclonal antibody