OTOP1 polyclonal antibody
  • OTOP1 polyclonal antibody

OTOP1 polyclonal antibody

Ref: AB-PAB22689
OTOP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OTOP1.
Información adicional
Size 100 uL
Gene Name OTOP1
Gene Alias MGC163302|MGC163304
Gene Description otopetrin 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NGVLNESKHQLNEHKEWLITLGFGNITTVLDDHTPQCNCTPPTLCTAISHGI
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OTOP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 133060
Iso type IgG

Enviar uma mensagem


OTOP1 polyclonal antibody

OTOP1 polyclonal antibody