SCGB1D2 polyclonal antibody
  • SCGB1D2 polyclonal antibody

SCGB1D2 polyclonal antibody

Ref: AB-PAB22677
SCGB1D2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SCGB1D2.
Información adicional
Size 100 uL
Gene Name SCGB1D2
Gene Alias LIPB|LPHB
Gene Description secretoglobin, family 1D, member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FCPALVSELLDFFFISEPLFKLSLAKFDAPPEAVAAKLGVKRCTDQMSLQKRSLIAEVLVKILKKCS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SCGB1D2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10647
Iso type IgG

Enviar uma mensagem


SCGB1D2 polyclonal antibody

SCGB1D2 polyclonal antibody