KIAA0556 polyclonal antibody
  • KIAA0556 polyclonal antibody

KIAA0556 polyclonal antibody

Ref: AB-PAB22658
KIAA0556 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA0556.
Información adicional
Size 100 uL
Gene Name KIAA0556
Gene Alias -
Gene Description KIAA0556
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq EPPVDYSDDFELCGDVTLQANNTSEDRPQELRRSLELSVNLQRKQKDCSSDEYDSIEEDILSEPEPEDPALVGHPRHDRPPSSGDWTQKDVHGE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA0556.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23247
Iso type IgG

Enviar uma mensagem


KIAA0556 polyclonal antibody

KIAA0556 polyclonal antibody