TTC22 polyclonal antibody
  • TTC22 polyclonal antibody

TTC22 polyclonal antibody

Ref: AB-PAB22657
TTC22 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TTC22.
Información adicional
Size 100 uL
Gene Name TTC22
Gene Alias FLJ20619
Gene Description tetratricopeptide repeat domain 22
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GMPDRNHLACAKADLEEVVRVCPGFKAYLDIGQVYYYMGVDAVQELLAVDEAALNQALVFLAKAGESELGATLPELQLLRGKCLRIKGED
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TTC22.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55001
Iso type IgG

Enviar uma mensagem


TTC22 polyclonal antibody

TTC22 polyclonal antibody