C11orf73 polyclonal antibody
  • C11orf73 polyclonal antibody

C11orf73 polyclonal antibody

Ref: AB-PAB22655
C11orf73 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C11orf73.
Información adicional
Size 100 uL
Gene Name C11orf73
Gene Alias FLJ43020|HSPC138|HSPC179|L7RN6
Gene Description chromosome 11 open reading frame 73
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKI
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C11orf73.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51501
Iso type IgG

Enviar uma mensagem


C11orf73 polyclonal antibody

C11orf73 polyclonal antibody