FBLN7 polyclonal antibody
  • FBLN7 polyclonal antibody

FBLN7 polyclonal antibody

Ref: AB-PAB22648
FBLN7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FBLN7.
Información adicional
Size 100 uL
Gene Name FBLN7
Gene Alias DKFZp547D0610|FLJ37440|TM14
Gene Description fibulin 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ASQNCLSKQQLLSAIRQLQQLLKGQETRFAEGIRHMKSRLAALQNSVGRVGPDALPVSCPALNTPADGRKFGSKYLVDHE
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FBLN7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 129804
Iso type IgG

Enviar uma mensagem


FBLN7 polyclonal antibody

FBLN7 polyclonal antibody