ABCB7 polyclonal antibody
  • ABCB7 polyclonal antibody

ABCB7 polyclonal antibody

Ref: AB-PAB22645
ABCB7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ABCB7.
Información adicional
Size 100 uL
Gene Name ABCB7
Gene Alias ABC7|ASAT|Atm1p|EST140535
Gene Description ATP-binding cassette, sub-family B (MDR/TAP), member 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq GAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDNPKWEAKKENISKEEERKKLQEEI
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ABCB7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 22
Iso type IgG

Enviar uma mensagem


ABCB7 polyclonal antibody

ABCB7 polyclonal antibody