UQCC polyclonal antibody
  • UQCC polyclonal antibody

UQCC polyclonal antibody

Ref: AB-PAB22641
UQCC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UQCC.
Información adicional
Size 100 uL
Gene Name UQCC
Gene Alias BFZB|C20orf44|CBP3|MGC104353|MGC141902|STQTL14
Gene Description ubiquinol-cytochrome c reductase complex chaperone
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RSGKYMCRIIVHFMWEDVQQRGRVMGVNPYILKKNMILMTNHFYAAILGYDEGILSDDHGLAAALWRTFFNRKCEDPRHLELLVEYVRKQIQYLDSMNGEDLLLTGEVSWRPLVEKNPQSILKPHSP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UQCC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55245
Iso type IgG

Enviar uma mensagem


UQCC polyclonal antibody

UQCC polyclonal antibody