FAM92A1 polyclonal antibody
  • FAM92A1 polyclonal antibody

FAM92A1 polyclonal antibody

Ref: AB-PAB22636
FAM92A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM92A1.
Información adicional
Size 100 uL
Gene Name FAM92A1
Gene Alias FLJ38979
Gene Description family with sequence similarity 92, member A1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KTIFSEFITIEMLFHGKALEVYTAAYQNIQNIDEDEDLEVFRNSLYAPDYSSRLDIVRANSKSPLQRSLSAKCVSGTGQEAGWAATCQTLI
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM92A1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 137392
Iso type IgG

Enviar uma mensagem


FAM92A1 polyclonal antibody

FAM92A1 polyclonal antibody