PHOSPHO2 polyclonal antibody
  • PHOSPHO2 polyclonal antibody

PHOSPHO2 polyclonal antibody

Ref: AB-PAB22635
PHOSPHO2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PHOSPHO2.
Información adicional
Size 100 uL
Gene Name PHOSPHO2
Gene Alias MGC111048|MGC22679
Gene Description phosphatase, orphan 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QIVYIGDGGNDVCPVTFLKNDDVAMPRKGYTLQKTLSRMSQNLEPMEYSVVVWSSGVDIISHLQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PHOSPHO2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 493911
Iso type IgG

Enviar uma mensagem


PHOSPHO2 polyclonal antibody

PHOSPHO2 polyclonal antibody