ZNF846 polyclonal antibody
  • ZNF846 polyclonal antibody

ZNF846 polyclonal antibody

Ref: AB-PAB22627
ZNF846 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF846.
Información adicional
Size 100 uL
Gene Name ZNF846
Gene Alias -
Gene Description zinc finger protein 846
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq AEKLYDSNHSGKVFNEHPFLMTHMITHIGEKTSEDNQSGKALRKNFPHSFYKKSHAEGKMPKCVKHE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF846.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 162993
Iso type IgG

Enviar uma mensagem


ZNF846 polyclonal antibody

ZNF846 polyclonal antibody