ZIM3 polyclonal antibody
  • ZIM3 polyclonal antibody

ZIM3 polyclonal antibody

Ref: AB-PAB22624
ZIM3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZIM3.
Información adicional
Size 100 uL
Gene Name ZIM3
Gene Alias MGC138876|MGC138877|ZNF657
Gene Description zinc finger, imprinted 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NYSNLVSVGQGETTKPDVILRLEQGKEPWLEEEEVLGSGRAEKNGDIGGQIWKPKDVKESLAREVPSINKETLTTQKGVECDGSKK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZIM3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 114026
Iso type IgG

Enviar uma mensagem


ZIM3 polyclonal antibody

ZIM3 polyclonal antibody