FAM184A polyclonal antibody
  • FAM184A polyclonal antibody

FAM184A polyclonal antibody

Ref: AB-PAB22623
FAM184A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM184A.
Información adicional
Size 100 uL
Gene Name FAM184A
Gene Alias C6orf60|FLJ13942
Gene Description family with sequence similarity 184, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq ELDTLKRSQLFTAESLQASKEKEADLRKEFQGQEAILRKTIGKLKTELQMVQDEAGSLLDKCQKLQTALAIAENNVQVLQKQLDDAKEGEMALLSKHKEVGSEL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM184A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79632
Iso type IgG

Enviar uma mensagem


FAM184A polyclonal antibody

FAM184A polyclonal antibody