ATAD2B polyclonal antibody
  • ATAD2B polyclonal antibody

ATAD2B polyclonal antibody

Ref: AB-PAB22621
ATAD2B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ATAD2B.
Información adicional
Size 100 uL
Gene Name ATAD2B
Gene Alias KIAA1240|MGC88424
Gene Description ATPase family, AAA domain containing 2B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LEVVSFCDSGDKCSSEQKILLEDQSKEKPETSTENHGDDLEKLEALECSNNEKLEPGSDVEVKDAELDKEGASKVKKYRK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ATAD2B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54454
Iso type IgG

Enviar uma mensagem


ATAD2B polyclonal antibody

ATAD2B polyclonal antibody