SNRNP27 polyclonal antibody
  • SNRNP27 polyclonal antibody

SNRNP27 polyclonal antibody

Ref: AB-PAB22618
SNRNP27 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SNRNP27.
Información adicional
Size 100 uL
Gene Name SNRNP27
Gene Alias RY1
Gene Description small nuclear ribonucleoprotein 27kDa (U4/U6.U5)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq TSPSPSRLKERRDEEKKETKETKSKERQITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNR
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SNRNP27.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 11017
Iso type IgG

Enviar uma mensagem


SNRNP27 polyclonal antibody

SNRNP27 polyclonal antibody