SHANK1 polyclonal antibody
  • SHANK1 polyclonal antibody

SHANK1 polyclonal antibody

Ref: AB-PAB22615
SHANK1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SHANK1.
Información adicional
Size 100 uL
Gene Name SHANK1
Gene Alias SPANK-1|SSTRIP|synamon
Gene Description SH3 and multiple ankyrin repeat domains 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TVKASIISELSSKLQQFGGSSAAGGALPWARGGSGGGGDSHHGGASYVPERTSSLQRQRLSDDSQSSLLSKPVSSLFQNWPKPPLP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SHANK1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 50944
Iso type IgG

Enviar uma mensagem


SHANK1 polyclonal antibody

SHANK1 polyclonal antibody