PUSL1 polyclonal antibody
  • PUSL1 polyclonal antibody

PUSL1 polyclonal antibody

Ref: AB-PAB22606
PUSL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PUSL1.
Información adicional
Size 100 uL
Gene Name PUSL1
Gene Alias FLJ90811
Gene Description pseudouridylate synthase-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq WTLPADCLDMVAMQEAAQHLLGTHDFSAFQSAGSPVPSPVRTLRRVSVSPGQASPLVTPEESRKLRFWNLEFESQSFLY
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PUSL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 126789
Iso type IgG

Enviar uma mensagem


PUSL1 polyclonal antibody

PUSL1 polyclonal antibody