UST polyclonal antibody
  • UST polyclonal antibody

UST polyclonal antibody

Ref: AB-PAB22603
UST polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UST.
Información adicional
Size 100 uL
Gene Name UST
Gene Alias 2OST
Gene Description uronyl-2-sulfotransferase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YNRVGKCGSRTVVLLLRILSEKHGFNLVTSDIHNKTRLTKNEQMELIKNISTAEQPYLFTRHVHFLNFSRFG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UST.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10090
Iso type IgG

Enviar uma mensagem


UST polyclonal antibody

UST polyclonal antibody