HPDL polyclonal antibody
  • HPDL polyclonal antibody

HPDL polyclonal antibody

Ref: AB-PAB22601
HPDL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HPDL.
Información adicional
Size 100 uL
Gene Name HPDL
Gene Alias 4-HPPD-L|GLOXD1|MGC15668|RP4-534D1.1
Gene Description 4-hydroxyphenylpyruvate dioxygenase-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SPGEDPELGLEMTAGFGLGGLRLTALQAQPGSIVPTLVLAESLPGATTRQDQVEQFLARHKGPGLQHVGLYTPNIVEATEGVATAGGQFLAP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HPDL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84842
Iso type IgG

Enviar uma mensagem


HPDL polyclonal antibody

HPDL polyclonal antibody