LCLAT1 polyclonal antibody
  • LCLAT1 polyclonal antibody

LCLAT1 polyclonal antibody

Ref: AB-PAB22596
LCLAT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LCLAT1.
Información adicional
Size 100 uL
Gene Name LCLAT1
Gene Alias AGPAT8|ALCAT1|FLJ37965|LYCAT|UNQ1849
Gene Description lysocardiolipin acyltransferase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LHPRTTGFTFVVDRLREGKNLDAVHDITVAYPHNIPQSEKHLLQGDFPREIHFHVHRYPIDTLPTSKEDLQLWCHKR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LCLAT1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 253558
Iso type IgG

Enviar uma mensagem


LCLAT1 polyclonal antibody

LCLAT1 polyclonal antibody