NLN polyclonal antibody
  • NLN polyclonal antibody

NLN polyclonal antibody

Ref: AB-PAB22595
NLN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NLN.
Información adicional
Size 100 uL
Gene Name NLN
Gene Alias AGTBP|DKFZp564F123|KIAA1226
Gene Description neurolysin (metallopeptidase M3 family)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LRMTLGREVMSPLQAMSSYTVAGRNVLRWDLSPEQIKTRTEELIVQTKQVYDAVGMLGIEEVTYENCL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NLN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57486
Iso type IgG

Enviar uma mensagem


NLN polyclonal antibody

NLN polyclonal antibody