PLCL1 polyclonal antibody
  • PLCL1 polyclonal antibody

PLCL1 polyclonal antibody

Ref: AB-PAB22594
PLCL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PLCL1.
Información adicional
Size 100 uL
Gene Name PLCL1
Gene Alias MGC126580|MGC138190|PLC-L|PLCE|PLCL|PLDL1
Gene Description phospholipase C-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LRYLVSRSKQPLDFMEGNQNTPRFMWLKTVFEAADVDGNGIMLEDTSVELIKQLNPTLKEAKIRLKFKEIQKSKEKLTTRVTEEEF
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PLCL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5334
Iso type IgG

Enviar uma mensagem


PLCL1 polyclonal antibody

PLCL1 polyclonal antibody