C6orf57 polyclonal antibody
  • C6orf57 polyclonal antibody

C6orf57 polyclonal antibody

Ref: AB-PAB22592
C6orf57 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C6orf57.
Información adicional
Size 100 uL
Gene Name C6orf57
Gene Alias MGC104225
Gene Description chromosome 6 open reading frame 57
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq SPLLCHSLRKTSSSQGGKSELVKQSLKKPKLPEGRFDAPEDSHLEKEPLEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCID
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C6orf57.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 135154
Iso type IgG

Enviar uma mensagem


C6orf57 polyclonal antibody

C6orf57 polyclonal antibody