ZZEF1 polyclonal antibody
  • ZZEF1 polyclonal antibody

ZZEF1 polyclonal antibody

Ref: AB-PAB22590
100 uL

Información del producto

ZZEF1 polyclonal antibody
Información adicional
Size 100 uL
Gene Name ZZEF1
Gene Alias FLJ10821|FLJ23789|FLJ45574|KIAA0399|MGC166929|ZZZ4
Gene Description zinc finger, ZZ-type with EF-hand domain 1
Storage Conditions Store at 4C. For long term storage store at -20C.Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LNDRSLLPALSCVQTALLHLLDMGWEPNDLAFFVDIQLPDLLMKMSQENISVHDSVISQWSEEDELADAKQNSEWMDECQDGMF
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZZEF1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23140
Iso type IgG

Enviar uma mensagem


ZZEF1 polyclonal antibody

ZZEF1 polyclonal antibody