KIAA1919 polyclonal antibody
  • KIAA1919 polyclonal antibody

KIAA1919 polyclonal antibody

Ref: AB-PAB22589
KIAA1919 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA1919.
Información adicional
Size 100 uL
Gene Name KIAA1919
Gene Alias MGC33953|NaGLT1
Gene Description KIAA1919
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SGLNEYEEENEEEDAEKWNEMDFEMIETNDTMRHSIIETSRSSLTEPTAEVYNQYPSNALVFESSPFNTGSAHVKHLPETR
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA1919.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91749
Iso type IgG

Enviar uma mensagem


KIAA1919 polyclonal antibody

KIAA1919 polyclonal antibody