GPR107 polyclonal antibody
  • GPR107 polyclonal antibody

GPR107 polyclonal antibody

Ref: AB-PAB22579
GPR107 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GPR107.
Información adicional
Size 100 uL
Gene Name GPR107
Gene Alias DKFZp667C222|FLJ16312|FLJ20998|FLJ22591|GCDRP|KIAA1624|LUSTR1|MGC126118|MGC15440|RP11-88G17|bA138E2.2
Gene Description G protein-coupled receptor 107
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KFRPASDNPYLQLSQEEEDLEMESVVTTSGVMESMKKVKKVTNGSVEPQGEWEGSV
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GPR107.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57720
Iso type IgG

Enviar uma mensagem


GPR107 polyclonal antibody

GPR107 polyclonal antibody