MB21D1 polyclonal antibody
  • MB21D1 polyclonal antibody

MB21D1 polyclonal antibody

Ref: AB-PAB22578
MB21D1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MB21D1.
Información adicional
Size 100 uL
Gene Name MB21D1
Gene Alias MGC131892|MGC142166|MGC142168
Gene Description chromosome 6 open reading frame 150
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RKQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MB21D1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 115004
Iso type IgG

Enviar uma mensagem


MB21D1 polyclonal antibody

MB21D1 polyclonal antibody