EPG5 polyclonal antibody
  • EPG5 polyclonal antibody

EPG5 polyclonal antibody

Ref: AB-PAB22577
EPG5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EPG5.
Información adicional
Size 100 uL
Gene Name EPG5
Gene Alias HEEW1|KIAA1632|hEPG5
Gene Description ectopic P-granules autophagy protein 5 homolog (C. elegans)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VGRELLGTITAVHPEIISVLLDRVQETIDQVGMVSLYLFKELPLYLWQPSASEIAVIRDWLLNYNLTVVKNKLACVILEGLNWGFAKQATLHLDQAVHAEVALMVLEAYQKYLAQKPYAGILSESMKQV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EPG5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57724
Iso type IgG

Enviar uma mensagem


EPG5 polyclonal antibody

EPG5 polyclonal antibody