MUC17 polyclonal antibody
  • MUC17 polyclonal antibody

MUC17 polyclonal antibody

Ref: AB-PAB22573
MUC17 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MUC17.
Información adicional
Size 100 uL
Gene Name MUC17
Gene Alias MUC3
Gene Description mucin 17, cell surface associated
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NPTSTPTVPRTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MUC17.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 140453
Iso type IgG

Enviar uma mensagem


MUC17 polyclonal antibody

MUC17 polyclonal antibody