FOXRED2 polyclonal antibody
  • FOXRED2 polyclonal antibody

FOXRED2 polyclonal antibody

Ref: AB-PAB22571
FOXRED2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FOXRED2.
Información adicional
Size 100 uL
Gene Name FOXRED2
Gene Alias FLJ23322|FLJ33734
Gene Description FAD-dependent oxidoreductase domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq CVLGAGPAGLQMAYFLQRAGRDYAVFERAPRPGSFFTRYPRHRKLISINKRYTGKANAEFNLRHDWNSLLSHDPRLLFRHYSRAYFPDARDMVRYLGDFADTLGLRVQYNTTIAHVTLDKDRQAWNGHYFILTDQKG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FOXRED2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80020
Iso type IgG

Enviar uma mensagem


FOXRED2 polyclonal antibody

FOXRED2 polyclonal antibody