ASCC3 polyclonal antibody
  • ASCC3 polyclonal antibody

ASCC3 polyclonal antibody

Ref: AB-PAB22570
ASCC3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ASCC3.
Información adicional
Size 100 uL
Gene Name ASCC3
Gene Alias ASC1p200|DJ467N11.1|HELIC1|MGC26074|RNAH|dJ121G13.4
Gene Description activating signal cointegrator 1 complex subunit 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QLNNMDEVCYENVLKQVKAGHQVMVFVHARNATVRTAMSLIERAKNCGHIPFFFPTQGHDYVLAEKQVQRSRNKQVRELFPDGFSIHHAG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ASCC3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10973
Iso type IgG

Enviar uma mensagem


ASCC3 polyclonal antibody

ASCC3 polyclonal antibody