CXorf58 polyclonal antibody
  • CXorf58 polyclonal antibody

CXorf58 polyclonal antibody

Ref: AB-PAB22564
CXorf58 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CXorf58.
Información adicional
Size 100 uL
Gene Name CXorf58
Gene Alias FLJ25444
Gene Description chromosome X open reading frame 58
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq THEILKKVAPLEAKLIKDPTMQCKIRFRFRGETFPPFIVFKIFLHTDGHGYKYFSGKNVLMPSSKAVDDACKLMGERKFHRIIMEDER
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CXorf58.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 254158
Iso type IgG

Enviar uma mensagem


CXorf58 polyclonal antibody

CXorf58 polyclonal antibody